Unidentified tmRNA

This genome may have a tmRNA, but we either did not inspect the sequence using our algorithm, or it may have had only an imperfect match to our validated tmRNA sequences

SmpB

Coordinates: NC_015153.1/669114-668719

Translation:IylqsnkkqlykynIfrsytagisltskvvgeilkgslnllgsygkvigselflvnfaaskwrllLtrreinqIsdlvkrekyvIIpg
glflqnrkikvelnlckynrnyeketskkykrnkrnkysddeyZ

Abbreviated Taxomony

Tenericutes: Mycoplasma: Mycoplasma suis KI3806

No identical tmRNA Sequences